PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID KHN44268.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Phaseoleae; Glycine; Soja
Family MYB
Protein Properties Length: 338aa    MW: 39008.9 Da    PI: 8.9232
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
KHN44268.1genomeTCUHKView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding574.5e-181560147
                     TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS
  Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47
                     rg W + Ede+l ++v+q+G  +W++Ia++++ gR++k+c++rw++ 
       KHN44268.1 15 RGHWRPAEDEKLRQLVEQYGAQNWNSIAEKLQ-GRSGKSCRLRWFNQ 60
                     899*****************************.***********996 PP

2Myb_DNA-binding60.24.3e-1967110146
                      TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHH CS
  Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqk 46 
                      r ++T+eE+e+l+ a++ +G++ W++Iar ++ gRt++ +k++w+ 
       KHN44268.1  67 RRPFTEEEEERLLAAHRIHGNK-WALIARLFP-GRTDNAVKNHWHV 110
                      679*******************.*********.***********96 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129419.3361061IPR017930Myb domain
SuperFamilySSF466891.31E-2914108IPR009057Homeodomain-like
SMARTSM007178.4E-151463IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.601.6E-271668IPR009057Homeodomain-like
CDDcd001671.00E-131859No hitNo description
PfamPF139212.5E-171878No hitNo description
PROSITE profilePS5129428.36662116IPR017930Myb domain
SMARTSM007172.4E-1666114IPR001005SANT/Myb domain
CDDcd001671.47E-769109No hitNo description
Gene3DG3DSA:1.10.10.601.2E-2169115IPR009057Homeodomain-like
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 338 aa     Download sequence    Send to blast
MEDSSAGEDT RTCPRGHWRP AEDEKLRQLV EQYGAQNWNS IAEKLQGRSG KSCRLRWFNQ  60
LDPRINRRPF TEEEEERLLA AHRIHGNKWA LIARLFPGRT DNAVKNHWHV IMARKQREQS  120
KLCGKRSFQD VYNDSNNTFL EKRTTPQSHH QDMLFSTTRF GLENGRFFDF RSLDNNKDDD  180
NNYRIVSDTT SSTSLASWNF ASVPTTTSTT TKGARDYFNT SRSSSVYLSE CSRSSDRSFL  240
YRIYPNPAFS LPNYKRVVPT SPFRTFLGSS DHHDGRIIKR DLMSFCDNNN NNSSSTFSKL  300
KASTEKDHQQ QQTNEDETNV EPKEVPFIDF LGVGVSSS
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1a5j_A6e-32151157107B-MYB
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAP0150351e-159AP015035.1 Vigna angularis var. angularis DNA, chromosome 2, almost complete sequence, cultivar: Shumari.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_003522557.20.0PREDICTED: transcription factor LAF1-like
TrEMBLA0A0R0KHA60.0A0A0R0KHA6_SOYBN; Uncharacterized protein
TrEMBLA0A0B2SHG30.0A0A0B2SHG3_GLYSO; Transcription factor MYB44
STRINGGLYMA04G42110.20.0(Glycine max)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF23034243
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G17950.11e-63myb domain protein 52
Publications ? help Back to Top
  1. Qi X, et al.
    Identification of a novel salt tolerance gene in wild soybean by whole-genome sequencing.
    Nat Commun, 2014. 5: p. 4340
    [PMID:25004933]